PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g07440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 795aa    MW: 88379.8 Da    PI: 4.7631
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g07440.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.78.2e-11656699146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+W++++ el+++a+++lG++ ++ I + ++  +t+ q+k+++ k
   Vang07g07440.1 656 RGKWSKQDTELFYEAIRELGTD-FSMIQQLFP-DKTRRQIKLKYKK 699
                      89********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159634.8E-26649733No hitNo description
Gene3DG3DSA:1.10.10.608.2E-7652699IPR009057Homeodomain-like
PROSITE profilePS512939.337654702IPR017884SANT domain
SMARTSM007171.1E-9655703IPR001005SANT/Myb domain
SuperFamilySSF466895.16E-10657703IPR009057Homeodomain-like
CDDcd001672.75E-7658699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MNTSGNGAYA SALDLIHCLM DPFDDLLPEA PVARIRPGAK FAPKAKAKQR PRKEVPSSEH  60
ATSSKDAGNQ CQNVGPSTLN VPAKEYVGFI HHTQVHFPNS ESGNPEQVSV EGDSAALVDG  120
STITASDIGA GQNSTNFLES VCEAGPTDFD GDSVTNFVSE TNLNNVSAEI ELDPFSDILP  180
DLPARNVHKF KPKIKPRPRV GNMPASASCD VMMEKSVELP TSYSTDFQSF QSTSVLNQST  240
SLPLPTSEIL RKTYMPDKFG NTSSNVSISE DSKSLAAAIP SQLDSLNAML SGDAVHNGTR  300
DWPSTFGKSS GEAADIFSGL ESLDDFLTQA TTDTGKPALH SFNEKGAEEN FVTPVCSSIN  360
SFTECDNTQV QRCPEYHTPQ DPVTFNEATD LNESDTHTKN RMSETEEIED LNPAYPRDDV  420
FDYQSMKSGE DPTYGIPNKR SSISGEEDNG GKTSRQRRKL AACKPRNSSF NEDVEDDNDI  480
DPPYHSNEHE LQENDDDYEV DHSSKKKRGS KSSQKKSVAK SGKTSRRRKK ADDDLQKTKE  540
PPKKFSHSTR RKKRCVDKAL LEIPEDELDP RTLPIKDIIL LAEHRERQAK KDAMTSNMSP  600
SNQSGGDSLH GAGAYNEQEF SGSEDGGDPY DDQDNERIDS TPVLYNYHTF MEKTPRGKWS  660
KQDTELFYEA IRELGTDFSM IQQLFPDKTR RQIKLKYKKE EREHYLRLRD AIHNRAKDHS  720
HYNLLIERLQ QSSTKAEEVM DPTTGTNEEV VEAATIKHDV DVKEQEVSAA VQSPEEYDDS  780
EDDSLKWSQY KSLY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520701.10.0PREDICTED: uncharacterized protein LOC106777581
RefseqXP_014520702.10.0PREDICTED: uncharacterized protein LOC106777581
RefseqXP_014520703.10.0PREDICTED: uncharacterized protein LOC106777581
RefseqXP_014520704.10.0PREDICTED: uncharacterized protein LOC106777581
RefseqXP_014520705.10.0PREDICTED: uncharacterized protein LOC106777581
TrEMBLA0A0S3T6630.0A0A0S3T663_PHAAN; Uncharacterized protein
STRINGGLYMA01G43821.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-48MYB_related family protein